Protein Info for GFF2849 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type IV pilin PilA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details PF10947: DUF2628" amino acids 35 to 117 (83 residues), 29.7 bits, see alignment E=7.5e-11 PF00114: Pilin" amino acids 177 to 277 (101 residues), 38.6 bits, see alignment E=1.8e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF2849 Type IV pilin PilA (Hydrogenophaga sp. GW460-11-11-14-LB1)
VGAFKADEPLWRAAIGPKKADHFLPIFAGFAVAGKPSLSWNTPAFFVTYFWLLHRKLWSR
VALYFFVPLVISVVVSAAQAAGGKEAAGLFLLIWLAYLAGMFLVPGLGGNGWLYKKYKAL
IAEAKAMHKTLDAQVAYVAAKGGTSHAGLIIGLVFVLIFMTGILAAVALPAYQDYTVRAR
MSEARVYANHLKSNFEVLYERDRRIPSARALVPAGVTSKYVRDFEVLDNGGIRVYLNFTP
IDGKSFVLTPALDKDGKWSWSCGTVDVLPRHLPQDCRTAVTVK