Protein Info for GFF2849 in Methylophilus sp. DMC18

Annotation: Transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF08529: NusA_N" amino acids 4 to 124 (121 residues), 114.8 bits, see alignment E=7.3e-37 TIGR01953: transcription termination factor NusA" amino acids 5 to 341 (337 residues), 400.6 bits, see alignment E=5.3e-124 PF00575: S1" amino acids 137 to 194 (58 residues), 28.9 bits, see alignment 3.1e-10 PF13184: KH_5" amino acids 229 to 296 (68 residues), 96.2 bits, see alignment E=2.5e-31 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 364 to 413 (50 residues), 64 bits, see alignment 1e-21 amino acids 437 to 486 (50 residues), 55.7 bits, see alignment 4.1e-19 PF14520: HHH_5" amino acids 430 to 483 (54 residues), 39.5 bits, see alignment 1.6e-13

Best Hits

Swiss-Prot: 59% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 84% identity to mmb:Mmol_0210)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>GFF2849 Transcription termination/antitermination protein NusA (Methylophilus sp. DMC18)
MSRELLLLVDALAHEKNVDKEVIFTALELALASATKKNHEEGADIRVEIDRETGDYKTFR
RWQYVEYDLLESSAYQFDEEDERAAGRQIGDYYEEPLESISFGRIGAQAAKQVILQKVRE
AEREQMIQDFLARGESLVTGVIKRMEKGNAIIEVGRIECLLPREAMIQKENLRVGDRVRA
YLSRVDRGGRGPQLILSRVAPEFLKRLFELEVPEIEEGLLEIRSAARDPGLRSKIAVKTN
DQRLDPVGTCVGMRGSRVQAVTSELGGERVDIVLWSMDPAQFVINALAPAEVTSIVVDED
AHSMDVVVNEEQLAVAIGRNGQNVRLASELTGWNLNILTEEAAAQKSQDEYAKISQLFIE
KLDVDEEVADILVQEGFSTLEEIAYVPLAEMAEIEAFDEDTINELRSRARAALLTEAIAK
EEKVEEDTNDLMTLDGMDADTAHKLAASEIHTSEDLAELAVDELVELTGIDEERAKSLIM
TARAPWFK