Protein Info for PS417_14535 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 72 to 203 (132 residues), 64.9 bits, see alignment E=9.3e-22 PF12697: Abhydrolase_6" amino acids 74 to 337 (264 residues), 49 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_2386)

Predicted SEED Role

"Epoxide hydrolase (EC 3.3.2.9)" (EC 3.3.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.9

Use Curated BLAST to search for 3.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TW12 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PS417_14535 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MHAQLTRRFTHRSLFLALALSQFGVLGVAHAEMPEAPTRAVTSAQTAFGALKHIKAGLLD
VAYAEVGPATGPAVILLHGWPYDIDSYAQVAPLLAAKGYRVLIPYARGYGDTRFLSDKTL
RNGQPAALASDVIDFMDALKIKQAVLGGYDWGARSADIVSALWPERVKALVSVSGYLIGN
QAAGKNPLPPKAELQWWYQFYFATERGAAGYQKNTHDFAKLIWQLASPQWKFDDATFDRS
AKGLENPDHVAITVFNYRWRLGLVQGETQYAPLEQKLAQAPSIGVPTITLEGDANGAPHP
QPEDYAKRFTGKYAFRLINGGVGHNLPQEAPEAFAKAIIDADHL