Protein Info for GFF2843 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 159 to 175 (17 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 267 to 298 (32 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 329 (278 residues), 132.7 bits, see alignment E=7.3e-43

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 57% identity to lhk:LHK_00212)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF2843 hypothetical protein (Xanthobacter sp. DMC5)
MFHRDAGALKTSYGEEQAIFPVALDRWAVMVLVAVGALVVPFVAGPYWLGSILLPCLILS
LAAIGLNILTGYAGQLSLGSGAFMAVGAYAAVNLVIRLPWLPFPVSFVLAGMVAGAVGLA
FGLLSLRIRGFYVAVATLAAQFFIEWICTHIPWLVLNTPSGVVSTPTLFLFGFGFSSVPS
RYLVAFVTVVALAVVAKNLIRSSAGRALMAVRDHETAAELTGVDTTRAKLTAFAVSGFYC
GVAGALWAFLYLGNVEIEAFSLHRSFQILFMVIIGGLGSILGSFLGAAFIVLLPVAIANA
ATLFGEALKPDVLANLELMIFGALIVAFLIIEPSGLARLAVKARDRLRRWPLPY