Protein Info for GFF2843 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 379 (17 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 412 (391 residues), 174.4 bits, see alignment E=3.3e-55 amino acids 277 to 448 (172 residues), 56.6 bits, see alignment E=2.2e-19 PF00083: Sugar_tr" amino acids 44 to 187 (144 residues), 32.2 bits, see alignment E=5.6e-12

Best Hits

Swiss-Prot: 90% identical to YEBQ_ECOLI: Uncharacterized transporter YebQ (yebQ) from Escherichia coli (strain K12)

KEGG orthology group: K08169, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 99% identity to spt:SPA1030)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF2843 Putative transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEKTRADGLPLPQRYGAILTIIIGISMAVLDGAIANVALPTIATDLHASPASSIWIVNAY
QIAIVVSLLSLSFLGDMFGYHRIYKCGLVVFLLSSLFCALSDSLQMLTLARIAQGFGGAA
LMSVNTALIRLIYPQRHLGRGMGINSFIVAVSSAAGPTIAAAILSISSWKWLFLINVPLG
IIALILAIRFLPANIAHDTKPRFDLPSAVMNALTFGLLITALSGFAQGQSLTLIGAELLV
LVVVGFFFVRRQLSLPVPLLPIDLLRIPLFSLSIGTSICSFCAQMLAMVSLPFYLQTVLG
RSEVETGLLLTPWPLATMVMAPLAGYLIERLHAGLLGALGMVIMAAGLFALVMLPASPSD
LNIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASGMLGTARLLGQSTGAALVALML
NQFGDSGTHLSLLAAAILAILAAVVSGLRITQPRVQA