Protein Info for GFF2842 in Variovorax sp. SCN45

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00140: Sigma70_r1_2" amino acids 68 to 101 (34 residues), 27.3 bits, see alignment 4.3e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 102 to 337 (236 residues), 112.1 bits, see alignment E=1.1e-36 PF04542: Sigma70_r2" amino acids 106 to 175 (70 residues), 72.2 bits, see alignment E=3.7e-24 PF04545: Sigma70_r4" amino acids 284 to 334 (51 residues), 47.1 bits, see alignment 2e-16

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 87% identity to vpe:Varpa_2051)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF2842 RNA polymerase sigma factor RpoS (Variovorax sp. SCN45)
MAASRPRRTPTVRGSVGKGSVLPPSSGDADENPEQNFPSLEAAADALAANAALPNGAMAE
LIGGEGADALTIYLRQVRRTELFTPAEEYQAACAARAGDFAARQSMIEHNLRLVVSIAKG
YLGRGVPMSDLIEEGNLGLMHAITKFEPERGFRFSTYATWWIRQSVERAVMTQARAIRLP
VHVVRELQQVLRARRTLEGDAEFLAHRPDGVRVEDIAALLGRDVQAVADLLALAEAPRSL
DAGDARGDDGFTLADTVASDDEQSSPSGATHAHEVERLLDQWVHALDAREREVLEGRYGL
HDREPETLEVLSVRLGLTRERVRQIQNEALAKMRRQLARSGVGRDALF