Protein Info for GFF2839 in Sphingobium sp. HT1-2

Annotation: Inner membrane transport permease YhhJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 320 to 336 (17 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 14 to 369 (356 residues), 51.5 bits, see alignment E=1.4e-17 PF12698: ABC2_membrane_3" amino acids 25 to 364 (340 residues), 125.6 bits, see alignment E=3.9e-40 PF01061: ABC2_membrane" amino acids 180 to 337 (158 residues), 88.7 bits, see alignment E=6e-29

Best Hits

Swiss-Prot: 63% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 73% identity to pla:Plav_3447)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF2839 Inner membrane transport permease YhhJ (Sphingobium sp. HT1-2)
MLATISNIYRLGVKELWSLWRDPIMLVLILFVFTVSIYTSANSKPETLHNAAIAIVDEDE
SPLSQRIVAAFYPPQFTLPRMIAPAQIDPGMDAGDFTFVLHIPHGFQRDVLAGRTAEIQL
NTDATRMSQAFSGSSYVQQIATAEVNEFVNRYRANSVPKVDLAVRARFNPTLNHTWFGAL
AQIINQIAMLSIILTGAALIREREHGTIEHLLVMPVTPFEIMLSKVWSMGLVVLLASSLS
INLVVQGLMHVPVAGSLALFFAGAALVLFSTTSMGIFLATLARNMPQFGMLMILVLLPLQ
MLSGGTTPRESMPKLVQDVMLFAPTTHFVELGQAILFRGAGIGVVWPQFAATAAIGIAFF
LIALTRFRRTISAMA