Protein Info for GFF2834 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator of maltose utilization, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00356: LacI" amino acids 11 to 51 (41 residues), 58.1 bits, see alignment 1.2e-19 PF00532: Peripla_BP_1" amino acids 83 to 317 (235 residues), 57.1 bits, see alignment E=4.2e-19 PF13407: Peripla_BP_4" amino acids 123 to 291 (169 residues), 36.3 bits, see alignment E=9e-13 PF13377: Peripla_BP_3" amino acids 182 to 339 (158 residues), 111.8 bits, see alignment E=7.8e-36

Best Hits

KEGG orthology group: None (inferred from 67% identity to nar:Saro_1887)

Predicted SEED Role

"Transcriptional regulator of maltose utilization, LacI family" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF2834 Transcriptional regulator of maltose utilization, LacI family (Sphingobium sp. HT1-2)
MAANDKVTSFDIATLAGVSQPTVSRALRGDKTVSEATRLRVEAIARQLNYTVDKNASSLR
RGKSNTLALLFFEDLLPDESWINPFFLSMLGPILQTCAKRGYDLLTSFQQLSTDWHVDYE
DSRKADGIILLGYGDYEIYRTRLEQLVAQGTHFVRWGSVDQHALGMTIGCDNRRGGRDAG
AHLIARGCSRIAFLGDASSHYPEFRDRYAGLSDVLREAGHAVDPGLHVDALSTEQSGYEA
ASRLIARGVTFDAIFAGSDLIAIGAMRALDEHGLSVPGDVALIGFDDIPAASLTRQPLTT
VAQDYLRAGEVLVDALIGQIDRKPVTPTLLAPRLITRMTA