Protein Info for GFF2834 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable major facilitator superfamily (MFS) transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 164 to 193 (30 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details PF05977: MFS_3" amino acids 9 to 525 (517 residues), 500 bits, see alignment E=7.4e-154 PF07690: MFS_1" amino acids 27 to 339 (313 residues), 100.5 bits, see alignment E=9.3e-33

Best Hits

KEGG orthology group: None (inferred from 68% identity to pol:Bpro_0736)

Predicted SEED Role

"Probable major facilitator superfamily (MFS) transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>GFF2834 Probable major facilitator superfamily (MFS) transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPQADDSLSPIAPLRLPVFRMLWTTWLMANICMWMSEVAAAWMMTSLTTKPLWVALVQTA
ATLPVFLLGLPSGALADNLDRKRYFLFTQLWVAAVATLLSAVIFLDIMTPPLLLVLIFAN
GIGMAMRWPVFSAIVPELVPRSQLPAALGLNGVSMNASRIIGPLAAGALIASAGSAWVFL
FNALLSIGAAVIISRWKREHIPNPLGRERLGSAMRVGLQYVAQSYLLKGVLLRISIFFFH
STALMALLALIARGMQDGGAGTFTLLLAAMGGGAIVSTAFLPRLRRRYSRDGLVWRGAAV
QATAMAVMAVTHQLWIAVPAMFLGGAAWITVANTLSVSIQMGLPDWVRARGMSIYQMAIM
GGSAAGAALWGQVATWTSVPICLGIAAVSGIAAMTLVNRLMPDAGLEDDLTPKRIFPAPS
IPEPPRHGHVMVHVEYRVDPARAAEFRLLMLNESRRSRLRHGALSWELLHDINEPGRFVE
VIVDESWTDHLRRFDRVTAADVALRDRKLAFHLGDEPPRVTRSLMETTV