Protein Info for GFF2832 in Variovorax sp. SCN45

Annotation: Uncharacterized protein PA4513

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details PF00258: Flavodoxin_1" amino acids 55 to 182 (128 residues), 98.6 bits, see alignment E=3.7e-32 PF00175: NAD_binding_1" amino acids 324 to 428 (105 residues), 45.7 bits, see alignment E=9.2e-16

Best Hits

KEGG orthology group: K00380, sulfite reductase (NADPH) flavoprotein alpha-component [EC: 1.8.1.2] (inferred from 77% identity to vpe:Varpa_2062)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>GFF2832 Uncharacterized protein PA4513 (Variovorax sp. SCN45)
MNEAAWRALGASSSVIAYGALCTAIYVRERRRKAAAVRAAAALSADSHDEPPTLVVFASQ
TGQAEAIAWQTAKQLRAAGTPVRVMELNALDAATLGTAGRALFIASTYGEGDAPDGASVF
CEQVMGSPPALGSLRYAVLALGDRQYANFCGFGRALDEWLHAAGAAREFERIEVDNSDPG
ALAEWQARWGSSDAVATAEEPDNAFAQWRLASRELLNPGSAGAPVFHLGFVPQAGPMPHW
SSGDLAQVAIASDPTHPRDYSISSLHSDGELQLLVRQEQHPDGTLGAASGLLTSTLTVGD
TVAMRLRPHRGFRLDGNEARPLILIGNGTGLAGLRAHLRARAAAGRHDNWLIFGERQQAH
DFLCRQEIEAWQAQGMLRRLDMVFSRDQPERFYVQHRLLQSADTLLQWLRDGAAIYVCGS
LKGMASGVDAALRQIAGEDLVRELSASGRYRRDVY