Protein Info for GFF2830 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: SSU ribosomal protein S4p (S9e)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to RS4_POLSJ: 30S ribosomal protein S4 (rpsD) from Polaromonas sp. (strain JS666 / ATCC BAA-500)
KEGG orthology group: None (inferred from 84% identity to xtr:100488077)MetaCyc: 65% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (207 amino acids)
>GFF2830 SSU ribosomal protein S4p (S9e) (Hydrogenophaga sp. GW460-11-11-14-LB1) VARYLGPKAKLSRREGADLLLKSARRSISDKAKFDSKPGQHGRTSGQRTSDFGVQLREKQ KVKRTYGVLERQFRRYFAEADRRRGNTGANLLFLLEARLDNVVFRMGFASTRAEARQIVS HKAITVNGQSVNIPSYSVKAGDVIAVREKSKKQGRVIEALELAKQIGFPAWVDVSTDKVE GVFKKSPDRDEFGSDINESLIVELYSR