Protein Info for GFF2828 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 69.8 bits, see alignment E=2.2e-23 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 59.9 bits, see alignment E=3.3e-20 PF01047: MarR" amino acids 10 to 62 (53 residues), 31.4 bits, see alignment E=2.9e-11 PF01037: AsnC_trans_reg" amino acids 71 to 144 (74 residues), 70.5 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 36% identical to AZLB_BACSU: Transcriptional regulator AzlB (azlB) from Bacillus subtilis (strain 168)

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 82% identity to sal:Sala_1974)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>GFF2828 Transcriptional regulator, AsnC family (Sphingobium sp. HT1-2)
MIELDHFERKILRELQRDASQTTAEIADKVGLTPSPCWRRIDRLEKEGLIRKRVALLDRR
KVGLNAQVFAQVKLNAHGRANLDEFSAAIGGFPEVLEAFVLLGTMDFMLRIVAKDIEAYE
RFFFERLSKLPGVQEINSTVALSEIKSTHELPI