Protein Info for GFF2826 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 24 to 153 (130 residues), 83.4 bits, E=2e-27
• TIGR00553: aminodeoxychorismate synthase, component I
  • amino acids 108 to 448 (341 residues), 441.6 bits, E=8.6e-137
• PF00425: Chorismate_bind
  • amino acids 193 to 444 (252 residues), 300 bits, E=1.6e-93

Best Hits

Swiss-Prot: 100% identical to PABB_SALTY: Aminodeoxychorismate synthase component 1 (pabB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 99% identity to seg:SG1293)

MetaCyc: 76% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (454 amino acids)

>GFF2826 Para-aminobenzoate synthase, aminase component (EC 2.6.1.85) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMKTLSPTVITLPWRPDAAEHYFAPVNHLPWAMLLHSGDAIHPYNRFDILVADPVTTLTT
RAQETTVCTARTTTVTLDDPLHVLQTQLEALPFHPQPDPDLPFQGGALGLFGYDLGRRFE
ILPDTAARDIALPDMAIGLYDWALIVDHQKQVVSLISYHDADARYRWLTSQRAPTRTPFR
LTSAWQSNMTRCEYGEKFRQVQAWLHSGDCYQVNLSQRFQASYEGDEWQAFERLNRANRA
PFSAFLRLHDGAILSLSPERFIQLENGHIQTRPIKGTLPRLNDPQADRQQAQKLANSMKD
RAENLMIVDLMRNDIGRVAVPGSVKVPELFVVEPFPAVHHLVSTITARLPDSLHATDLLR
AAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGKMDTSITIRTVTATQGQL
YCSAGGGIVADSNEEAEYQETFDKVNRILHPLEN