Protein Info for GFF2824 in Variovorax sp. SCN45

Annotation: TonB-dependent hemin, ferrichrome receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 38 to 737 (700 residues), 381.8 bits, see alignment E=6.9e-118 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 40 to 737 (698 residues), 413.9 bits, see alignment E=1.3e-127 PF07715: Plug" amino acids 53 to 170 (118 residues), 93.5 bits, see alignment E=1.8e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 267 to 698 (432 residues), 204 bits, see alignment E=1.2e-63 PF14905: OMP_b-brl_3" amino acids 342 to 732 (391 residues), 39.4 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 85% identity to vpe:Varpa_2070)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>GFF2824 TonB-dependent hemin, ferrichrome receptor (Variovorax sp. SCN45)
VAAKTNLRRSHRLALLPCLIASGLGLAAPSWAQRVAALNEVVVSGSRSEQSRDDLPVSTE
VISRDDIESKQITDIRDAVRDLPNVSVKRAPARFGLAQGNTGRDGNAGFNIRGLDGNRVL
LLTDGIRTPRSYVFSANAFGRDYFDISLVERIEIIKGPASALYGSDGLAGLVNFITRDPS
SYLRDGKTFGGSANIGYSGDDNGTHGGVTLAGKANDTMQWLISANMGRASALENMGTNNA
ANADRTTPNPQRDRNKALLAKVILTPNADQRHGFTFEHIDKTSRYDLLSGLSKPPYASTS
VIGLNAKSDLQRDRFTYDGRLRIDSAVADSLLAVVSYQKAKSREFIYEDRYTAADRTRDV
TYDEATWQFGLQADKTVRMGDWAQKITYGFDYTRTNVENLQTGLVPPAGETYPLKRFPDT
RETSSAFYVQDEFIHDRWSITPGIRFDRFSLDAKQAGFGAQAVSLSGSAVSPKLGVLFRA
TPQWSIYGNYASGFKAPNAFQVNNFFENVISGYKTIPNPNLKPEKSQNIELGMRGRTGVL
SYDVAAFTGDYKDLIENDRQVGGVFGSRTNPATFQSVNIGRARISGFEIKGELDFTDNGN
GFSVPFAYGQTRGRDRTNNRPLNSIDPSKAAIGIKYQAPVWMVRLDAVNHSRKKWSDIDP
TEVTTGTQFQTPAATTFDVSAQWRIRKDLRLNASVTNLTNKRYWMWSDVRGLTSTSTIRD
AYTQPGRSFNVSLVADF