Protein Info for GFF2823 in Variovorax sp. SCN45

Annotation: Hemin transport protein HmuS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF06228: ChuX_HutX" amino acids 24 to 157 (134 residues), 91.2 bits, see alignment E=5.5e-30 amino acids 211 to 351 (141 residues), 78.5 bits, see alignment E=4.7e-26 PF05171: HemS" amino acids 30 to 163 (134 residues), 114.9 bits, see alignment E=2.4e-37 amino acids 213 to 356 (144 residues), 122.7 bits, see alignment E=9.8e-40

Best Hits

KEGG orthology group: K07225, putative hemin transport protein (inferred from 82% identity to vpe:Varpa_2071)

Predicted SEED Role

"Hemin transport protein HmuS" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF2823 Hemin transport protein HmuS (Variovorax sp. SCN45)
MNAQDIRERFASLRAKGMRHKDAAAAMGLPEGAAVAAHTGAHDKALSATRLRGPWVELLQ
ALELCGPVLALTRNETTVHEKTGVYEKVSGSEAMGLALGEAIDLRLFFSRWHAGFAVSEA
AANAGVPPSLSLQFFDAQGVAVHKIFARDATDRDAFQSVVASFTAPDEPVAFVPAEAKAA
PLEDSAIDVGGLSDAWRAMQDTHEFFGLLNKFKVERQQSFRLTEGEFTQRAEPSAVRELL
QEASFDGTPIMVFVGSPGCIQIHSGPVVRIEPLEMRGADENAPPIRWLNVLDPGFNLHLR
EDRIASVWIVEKPTSDGIVTSVEAFDGSGELMAMFFGARKPGVPEREEWRRIVSELPRLQ
PAAQQP