Protein Info for GFF2816 in Xanthobacter sp. DMC5

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 7 to 198 (192 residues), 204.6 bits, see alignment E=2.2e-64 PF01370: Epimerase" amino acids 9 to 80 (72 residues), 29.2 bits, see alignment E=1.2e-10 PF08659: KR" amino acids 9 to 174 (166 residues), 56.8 bits, see alignment E=5.9e-19 PF13561: adh_short_C2" amino acids 17 to 253 (237 residues), 203.1 bits, see alignment E=1e-63

Best Hits

Swiss-Prot: 35% identical to YOXD_BACSU: Uncharacterized oxidoreductase YoxD (yoxD) from Bacillus subtilis (strain 168)

KEGG orthology group: K07535, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [EC: 1.1.1.-] (inferred from 86% identity to xau:Xaut_0911)

MetaCyc: 61% identical to BadH (Rhodopseudomonas palustris)
R267-RXN

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.100

Use Curated BLAST to search for 1.1.1.- or 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF2816 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Xanthobacter sp. DMC5)
VRGLKGKVVVVTGGGGGIGSATCRRFAEDGARVIVADISAAAAETVVEEIKAGGGEAIAL
VVDLTDYDAVAKAIATVEADFGPIDILVNNAGWDLFVPFLKSEPDFWSKIIDINLRAVLN
ITKPVLASMVARGQGGRIVSIGSDAGRVGSSGEAVYAACKAGVIAFMKTLARENARHGIT
FNTVCPGVTETAMLESFMEAAGDKEKLRTAFTRAVPLGRLGKPEDLPGAILFLSSDDAAF
ITGQVISVSGGLTMHG