Protein Info for GFF2816 in Xanthobacter sp. DMC5
Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 35% identical to YOXD_BACSU: Uncharacterized oxidoreductase YoxD (yoxD) from Bacillus subtilis (strain 168)
KEGG orthology group: K07535, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [EC: 1.1.1.-] (inferred from 86% identity to xau:Xaut_0911)MetaCyc: 61% identical to BadH (Rhodopseudomonas palustris)
R267-RXN
Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- (5Z)-dodecenoate biosynthesis I (6/6 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- (5Z)-dodecenoate biosynthesis II (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- cis-vaccenate biosynthesis (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- biotin biosynthesis I (11/15 steps found)
- palmitate biosynthesis III (21/29 steps found)
- 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
- stearate biosynthesis IV (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- petroselinate biosynthesis (2/6 steps found)
- benzoyl-CoA degradation III (anaerobic) (3/9 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (26/205 steps found)
- superpathway of mycolate biosynthesis (27/239 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fatty acid biosynthesis
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.100
Use Curated BLAST to search for 1.1.1.- or 1.1.1.100
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (256 amino acids)
>GFF2816 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Xanthobacter sp. DMC5) VRGLKGKVVVVTGGGGGIGSATCRRFAEDGARVIVADISAAAAETVVEEIKAGGGEAIAL VVDLTDYDAVAKAIATVEADFGPIDILVNNAGWDLFVPFLKSEPDFWSKIIDINLRAVLN ITKPVLASMVARGQGGRIVSIGSDAGRVGSSGEAVYAACKAGVIAFMKTLARENARHGIT FNTVCPGVTETAMLESFMEAAGDKEKLRTAFTRAVPLGRLGKPEDLPGAILFLSSDDAAF ITGQVISVSGGLTMHG