Protein Info for GFF2813 in Xanthobacter sp. DMC5

Annotation: Medium-chain fatty-acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 93 to 114 (22 residues), see Phobius details amino acids 253 to 270 (18 residues), see Phobius details amino acids 314 to 330 (17 residues), see Phobius details TIGR03208: cyclohexanecarboxylate-CoA ligase" amino acids 3 to 540 (538 residues), 814.6 bits, see alignment E=2.1e-249 PF00501: AMP-binding" amino acids 34 to 408 (375 residues), 271.9 bits, see alignment E=8e-85 PF13193: AMP-binding_C" amino acids 457 to 533 (77 residues), 57.1 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: K04116, cyclohexanecarboxylate-CoA ligase [EC: 6.2.1.-] (inferred from 84% identity to xau:Xaut_0914)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>GFF2813 Medium-chain fatty-acid--CoA ligase (Xanthobacter sp. DMC5)
MQFDAVLIAPRRARMEADGFWQGKTLLDYFEICLAEKPDAVAVLTVLTGTGARRELTYAE
LDRLAWRAAAGLRRLGLGKDDVLSCQLPNGWEFVVLYIACLRLGIVFNPVMPIFREHELS
FMLRHGETKVFAVPRVFRGFDHEAMAHRLKADLPDLRHLVVAGGAGPDAFEASLLDPALD
AEVPAIREISARDRSDANAVCQLIYTSGTTGEPKGVMHTANTMYSNLIAYAGRLGLGDAD
VVLMASPMAHQTGFMYGLLMPFMLKARMVLMDSWDKALAARLIAQEGVTFTMASTPFLMD
ITNTVEELGTDSSSLRIFLCAGTAIPGVLVERARKVLGTKIISAWGMTENGAVTVVSPSD
PDERSINTDGFVLPGMELQIRGADGAALPVGQEGALFVRGCSNFGGYLKRPQWNATDAEG
WFDTGDIARIDEKGYIRICGRTKDVIIRGAENLPVVEIESVLYKHPSIQQVAIVAYPDER
LGERACAFVVPKAGKSFSFEEMIAFLESQHLAKQYFPERMEVREQLPSTASGKIQKFALR
TLLREEYEQSRP