Protein Info for GFF2812 in Variovorax sp. SCN45

Annotation: Replicative DNA helicase (DnaB) (EC 3.6.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF00772: DnaB" amino acids 24 to 125 (102 residues), 110.7 bits, see alignment E=4.9e-36 TIGR00665: replicative DNA helicase" amino acids 24 to 460 (437 residues), 579.7 bits, see alignment E=1.8e-178 PF03796: DnaB_C" amino acids 202 to 458 (257 residues), 363.5 bits, see alignment E=8.6e-113 PF13481: AAA_25" amino acids 216 to 381 (166 residues), 47.3 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 47% identical to DNAB_HAEIN: Replicative DNA helicase (dnaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 96% identity to vpe:Varpa_2083)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>GFF2812 Replicative DNA helicase (DnaB) (EC 3.6.4.12) (Variovorax sp. SCN45)
MSAVFSYADNDPSADRQIAQLRIPPHSIEAESSVLGGLLLDNGAWDRMGDLLVDGDFYRH
EHKLIYAAIGGLINASKPADVITVYEQLQNLGKADEIGGLVYLNSLAQYVPSASNIRRYA
EIVRERSILRKLVSAADEIATQAFNPQGKQVDKILDEAEQKIFNIGEEGTRMKQGFQSMD
ALVVELLDRVTEMAENPNDITGIRTGFHDFDKMTSGLQPGDMIVLAARPSMGKTSLAINI
AEHVALEEGLPVAVFSMEMGASQLAVRIVGSIGRIDQGHLRTGKLSDEEWPRLTEAIEKL
RTVSLHIDETPGLSTSELRANARRLARQYGRLGLIVVDYLQLMSTSSSGDENRATAVGEI
SRGLKMLAKELKCPVIALSQLSRGVESRTDKRPMMSDLRESGAIEQDADIIMFIYRDDYY
DKNSKEPGVAEVIISKHRNGPTGTVKLAFLKPITKFENLASYSHNEQY