Protein Info for GFF2812 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 179 to 205 (27 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 259 (175 residues), 40.2 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 93% identity to aav:Aave_0607)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF2812 Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDKRRFRARTLFLIAYLIFALLPIYWMVNMSFKTNQEILSSFTLWPAEFTWANYRTIFTD
PSWYSGYINSLIYVGINTVISLTVALPAAYAFSRYRFLGDKHVFFWLLTNRMTPPAVFLL
PFFQLYTTLGLMDTHIAVAMAHLLFNVPLAVWILEGFMSGIPREIDETAYIDGYSFPRFF
FTIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIVATMTRTVSASGMDWATLA
AAGVLTIVPGAIVIWFVRHYIAKGFAMGRV