Protein Info for GFF2811 in Xanthobacter sp. DMC5

Annotation: Electron transfer flavoprotein-ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 PF01946: Thi4" amino acids 7 to 53 (47 residues), 30.6 bits, see alignment 8.1e-11 PF07992: Pyr_redox_2" amino acids 11 to 45 (35 residues), 26.3 bits, see alignment 2e-09 PF00890: FAD_binding_2" amino acids 12 to 51 (40 residues), 28.7 bits, see alignment 3.3e-10 PF13450: NAD_binding_8" amino acids 15 to 56 (42 residues), 32.4 bits, see alignment 3.8e-11 PF21162: ETFQO_UQ-bd" amino acids 210 to 303 (94 residues), 144.2 bits, see alignment E=5.8e-46 PF05187: Fer4_ETF_QO" amino acids 446 to 547 (102 residues), 152.8 bits, see alignment E=1.2e-48

Best Hits

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 80% identity to sil:SPO0316)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.1

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>GFF2811 Electron transfer flavoprotein-ubiquinone oxidoreductase (Xanthobacter sp. DMC5)
MTDIQREAMAYDVVIVGAGPAGLSAAIRLKQLDPDLSVVVLEKGSEVGAHILSGAVLDPC
GLDALIPDWRERGAPITVPVREDNFHFLTEAGSVRIPNWPMPRLMSNHGAYIVSMGNVCR
WMAERAEKLGVEIFPGMACSSLVYGDQGEVKGVVAGEFGRLADGTPGPAYEPGMELHGKY
VLLGEGVRGSLTKEVISRFDLGRGHCPQKFGIGMKEIWEIDPAKHKEGTVTHTMGWPLGS
SAGGGSFIYHIDNNQVYVGFVVHLNYANPYLSPYMEFQRFKHHPMVAELLAGGKRVAYGA
RAISEGGWQSIPTLAAPGVALLGCAAGLVNVPRIKGNHNAMLSGKAAAEAAHAAIADGRA
GDTLTAYETEVRNGAIGKDLKKVRNVKPLWSRYGLTASLMLGGLDMWTNDLFGASLLGTL
KHGKSDAASTGEARDFAPIAYPKPDGILSFDRLTNVAFSFTNHEESQPPHLKLADPALPV
AVNLPRFAEPAQRYCPAGVYEVVEADGAGPRFVVNFQNCVHCKTCDIKDPLQNITWTTPQ
GGDGPNYPNM