Protein Info for GFF2810 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00005: ABC_tran" amino acids 26 to 167 (142 residues), 86.6 bits, see alignment E=5e-28 PF13555: AAA_29" amino acids 28 to 69 (42 residues), 27.4 bits, see alignment 4.7e-10 PF17912: OB_MalK" amino acids 241 to 285 (45 residues), 34.2 bits, see alignment 7.8e-12 PF08402: TOBE_2" amino acids 279 to 347 (69 residues), 38.6 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 75% identity to pol:Bpro_0479)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF2810 Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MARIELDLAHAYRPNPKADEDYALLPLQMTFEDGGAYALLGPSGCGKTTMLNIMSGLLVP
SQGTVRFNGVDVTRQSPQQRNIAQVFQFPVIYDTMTVAQNLAFPLRNRKVPEAEIKDRVG
RIAEMLEMSHQLDQRAAGLSADQKQKISLGRGLVRSDVSAVLFDEPLTVIDPHLKWQLRR
KLKQIHHELKLTLIYVTHDQVEALTFADEVVVMTRGRAVQVGAAAALFERPAHTFVGHFI
GSPGMNFLPATSVRGGVVVLEHPLALTNGQVLPEGPVQLGIRPEYLAIGQAGEPDTLPAT
VTRVQDIGTYVMVSCEAGGHRLKCRLAPEATAPAVGETVQLRVLGRHTCFYKDEVLIA