Protein Info for GFF2809 in Sphingobium sp. HT1-2

Annotation: Gluconokinase (EC 2.7.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 77 to 98 (22 residues), see Phobius details PF13671: AAA_33" amino acids 19 to 153 (135 residues), 49 bits, see alignment E=1.3e-16 PF13238: AAA_18" amino acids 19 to 134 (116 residues), 29.8 bits, see alignment E=1.1e-10 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 20 to 168 (149 residues), 169.3 bits, see alignment E=2.9e-54 PF01202: SKI" amino acids 26 to 135 (110 residues), 33.1 bits, see alignment E=9.2e-12

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 65% identity to cse:Cseg_1860)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>GFF2809 Gluconokinase (EC 2.7.1.12) (Sphingobium sp. HT1-2)
LPISADPAPVSPKAVGRAVIVMGVSGCGKSTLGAMLAQALDCPFLEGDSYHSAAAVEKMR
GGQALTDDDRWPWLDRLGAAIAGTVAAQGLAVAACSALKRAYRDRLRAAIGVPVHFILLD
NDRDELLARLGNRPGHYMPASLLDSQLATLEPPLPEEGAMILTTNVPASELRDRALTWLG