Protein Info for GFF2808 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycerol-3-phosphate regulon repressor, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF12802: MarR_2" amino acids 2 to 51 (50 residues), 34 bits, see alignment 1e-11 PF25212: HVO_A0114" amino acids 3 to 55 (53 residues), 36.9 bits, see alignment E=9.9e-13 PF01047: MarR" amino acids 3 to 53 (51 residues), 27.4 bits, see alignment 9.9e-10 PF13412: HTH_24" amino acids 4 to 48 (45 residues), 24.4 bits, see alignment 7e-09 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 31.1 bits, see alignment 7.2e-11 PF08220: HTH_DeoR" amino acids 6 to 58 (53 residues), 57.1 bits, see alignment E=5e-19 PF12840: HTH_20" amino acids 10 to 49 (40 residues), 30.8 bits, see alignment 9.8e-11 PF00455: DeoRC" amino acids 75 to 232 (158 residues), 172.9 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 53% identical to GLPR_PSEAE: Glycerol-3-phosphate regulon repressor (glpR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 75% identity to lch:Lcho_3222)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF2808 Glycerol-3-phosphate regulon repressor, DeoR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNLNPRHTQLLDEVRAHGPQTIEALAERFGVTLQTVRRDVQRLAEAGLLSRFHGGVRQPG
STTENIAYRQRQAMQADAKTRIARAVARRVPNGCSLIMNIGTTIEAVARELQHHRGLRVI
TNNLHIASLMSTNPDCEVIVAGGLVRGADQGIVGEATVDFMRQFRVDIGLIGISGIEADG
TLRDFDYREVKVARAIVEQSREVWLAADHSKFNRPAMVELARLDDIDVVFTDLAPPSPFD
ELLAQANVECVRAGVDTDNA