Protein Info for GFF2808 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details PF02600: DsbB" amino acids 2 to 142 (141 residues), 146.4 bits, see alignment E=4.3e-47

Best Hits

Swiss-Prot: 100% identical to DSBB_SALTI: Disulfide bond formation protein B (dsbB) from Salmonella typhi

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 99% identity to sew:SeSA_A1949)

MetaCyc: 84% identical to protein thiol:quinone oxidoreductase DsbB (Escherichia coli K-12 substr. MG1655)
RXN-19950 [EC: 1.8.5.9]

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>GFF2808 Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIW
IYSAWRGLQLAYEHTMIQLHPSPFMTCDFMARFPDWLPLGKWLPQVFVASGDCAERQWSF
LTLEMPQWLLGIFAAYLVVAIAVVIAQAFKPKKRDLFGR