Protein Info for PS417_14320 in Pseudomonas simiae WCS417

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details PF01266: DAO" amino acids 5 to 394 (390 residues), 212.6 bits, see alignment E=4.5e-66 PF00890: FAD_binding_2" amino acids 5 to 42 (38 residues), 25.8 bits, see alignment 2.1e-09

Best Hits

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 88% identity to pfs:PFLU3327)

MetaCyc: 78% identical to D-hydroxyproline dehydrogenase subunit (Pseudomonas putida KT2442)
1.14.19.-

Predicted SEED Role

"D-amino acid dehydrogenase (EC 1.4.99.1) family protein in hydroxy-L-proline catabolic cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXS5 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PS417_14320 FAD-dependent oxidoreductase (Pseudomonas simiae WCS417)
MSDPDIVVVGAGIIGVACALQLARQGQQVWVVDQQEPGMGASYGNAGHLATEQVFPIADL
SILKRLPGMLLDPMGPLRLDWKYLPHALPWFLRLLLNLRPASYQRTVAGIRTLNEGSLGA
WQRLLHSIGHPQLLREDGSLLVFERADSRDALNALQQRMQQQQVPVDFWSGDAIRQAAPQ
LSDNLQGGLFFPGTGHFLDPYHVVCELVHAAKASGVQFLKRQVLDGRVDAHGVSLTTDQG
PLTARQVLIACGAHSARLTAALTGKKVPLDTERGYHLMLPHEHNRLPFAVTSLERKFIMT
PMADGLRLAGTVEFAGLDRPANMARAWQLHRLSKGLFREELSAEGATPWMGFRPSLPDSL
PVIDRVCDGKVLLAFGHQHLGLTQAAVTAEWVGALARTGQAPSVAPYRLDRF