Protein Info for GFF2807 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Na+/H+ antiporter NhaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 20 to 55 (36 residues), see Phobius details amino acids 62 to 62 (1 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 350 to 376 (27 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details PF06450: NhaB" amino acids 1 to 511 (511 residues), 991.5 bits, see alignment E=1e-302 TIGR00774: Na+/H+ antiporter NhaB" amino acids 1 to 512 (512 residues), 999.5 bits, see alignment E=2e-305 PF03600: CitMHS" amino acids 70 to 340 (271 residues), 70.9 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 100% identical to NHAB_SALHS: Na(+)/H(+) antiporter NhaB (nhaB) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 99% identity to sew:SeSA_A1948)

MetaCyc: 92% identical to Na+:H+ antiporter NhaB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-130

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>GFF2807 Na+/H+ antiporter NhaB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEISWGRAMWRNFLGQSPDWYKLALLVFLIVNPFIFLANPFIAGWLLVAEFIFTLAMALK
CYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFTRL
LLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSRGEENDMLD
DSHIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAAGWHFGDFFL
RMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKRTRQDKIKLI
VQAIIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESLPFTALLTVF
FSIVAVIIDQHLFAPIIQFVLQASEHAQLTLFYLFNGLLSSISDNVFVGTIYINEAKAAM
ENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRMVWMALP
YTIVLTLIGLLCVEFTLAPATEWMTQAGWLATLS