Protein Info for PS417_14305 in Pseudomonas simiae WCS417

Annotation: hydroxyproline-2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF05544: Pro_racemase" amino acids 6 to 308 (303 residues), 331.9 bits, see alignment E=2e-103

Best Hits

Swiss-Prot: 79% identical to 4HYPE_PSEPK: 4-hydroxyproline 2-epimerase (proR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K12658, 4-hydroxyproline epimerase [EC: 5.1.1.8] (inferred from 90% identity to pfs:PFLU3324)

MetaCyc: 79% identical to hydroxyproline 2-epimerase subunit (Pseudomonas putida)
4-hydroxyproline epimerase. [EC: 5.1.1.8]

Predicted SEED Role

"4-hydroxyproline epimerase (EC 5.1.1.8)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 5.1.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U207 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PS417_14305 hydroxyproline-2-epimerase (Pseudomonas simiae WCS417)
MKRLHVIDSHTGGEPTRLVMSGFPALSGATIADQLHSLRTEHDQWRRACLLEPRGNDVLV
GALYCEPVTPGAICGVIFFNNAGYLGMCGHGTIGLVASLHHLGRIQPGVHTIDTPVGPVA
ATLHEDGAVTLRNVPAYRLHQQVPVEVPGHGVVYGDIAWGGNWFFLVSDHGQRLQMDNVD
ALTDYTWAMLKALEDQGIHGADGALIDHIELFADDDRADSRNFVMCPGKAYDRSPCGTGT
SAKLACLAADGTLKPGETWTQASITGSQFDGHYEWDGERVRPFITGNAYMTADSTLLIDE
RDPFAWGI