Protein Info for GFF2804 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07626: PSD3" amino acids 52 to 117 (66 residues), 33.2 bits, see alignment E=1.5e-11 PF07637: PSD5" amino acids 140 to 201 (62 residues), 59.1 bits, see alignment E=1.1e-19 PF07631: PSD4" amino acids 215 to 342 (128 residues), 103.5 bits, see alignment E=3e-33 PF07627: PSCyt3" amino acids 362 to 462 (101 residues), 93.3 bits, see alignment E=2.4e-30 PF07624: PSD2" amino acids 474 to 541 (68 residues), 37.8 bits, see alignment E=3.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>GFF2804 hypothetical protein (Sphingobium sp. HT1-2)
MSRPFRHRARWTLLAGLLLSACTVEKAPQTAATPEASFAPLKTPLGQVAGMRRLTEAQYR
NSIADIFGPDIKVAGRFEPIVRPVHELIATGASASTISPAGLEQFDAMARNIAAQVFAPD
RRTQFMPCAPRDAAAPDADCAARTLMPIGRYLFRRPMTQEEIGAFVMMAGKGAGDGQGFY
DGMQLALAAMLVSPQFLYIIESAEPDPEAPGSLRLDNHARAARLSYLLWNTTPNEALLRA
ADEGKLTDPAQLAAIAQKMVRSPRLEDGVRAFFADMLLFEKFDEMAKDQIVYPRFNPDVA
SALSEQMLRMIVDQLVTRQGDYRDLFTTRRTFINRALGPLYQAKVSSMQGWMPYEFADGD
DRAGLLGQAGFLALYSHSGRSSPTLRGRAIRELLLCQPVPNPPGNVNFTAVQDVGNKAMP
TARIRLNAHNSDPVCAACHKITDPLGLPLERFDGIGAFRRTENDAPIDTAGVFEGTAFQG
NVGLGQALAASKSTTECVAGRAFQYATGRMPEDEEATAMALEQGFAADGYRIQALFLRVA
TMADAYRISTPPLAKPQVAMMTSPHIREGDRP