Protein Info for GFF2802 in Variovorax sp. SCN45

Annotation: DUF1176 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06674: DUF1176" amino acids 28 to 326 (299 residues), 267.4 bits, see alignment E=1.1e-83

Best Hits

Predicted SEED Role

"DUF1176 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF2802 DUF1176 domain-containing protein (Variovorax sp. SCN45)
MNLARVAVALSSLVALSVGAAGKEPVAFSHNDWELACDNTLTCRAAGYQADSGGSEPVSM
LVTRKAGPGTPIDVQLQIGDTDGVKGTLRFKVGKATVSGLEAGTASFDDSQVRAVLPELL
KGDEAQVTAGGGKKWVLSLSGLNAVLLKMDEAQGRVGTPGALVRKGTKPESSVLPPVPMP
VVDVPRPPKARAGDDALAARIFPSLDLKDAREQCNNQDQVNAKSMEVHRLNDRKVLLALG
CGVGAYNYTTLLWLANDKPPYAPVSLEASGEFDEKDASVTSAMKGRGIGDCWSAETWNFN
GKDFVRTGATGDGMCRGFAGGAWTLPRYVSRVVVTGPTATPSKP