Protein Info for GFF2800 in Sphingobium sp. HT1-2

Annotation: Cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 179 (171 residues), 78.8 bits, see alignment E=2.2e-26

Best Hits

KEGG orthology group: None (inferred from 54% identity to pzu:PHZ_c1139)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF2800 Cytochrome b (Sphingobium sp. HT1-2)
MANPARQYVWDLPIRLFHWSLVGLIGFSWWSAETYRMDWHRLSGQAVLFLIVFRLIWGLI
GSGPARFAQFLRGPRAIFAYLTGRVPAAPGHNPLGGWSVLAMLLALSVQVGTGLFAVDID
GIESGPLSHLVDFDQGRLASDIHGISFTILQMLIGLHVLAVLFYLLVRRRNLIGPMVSGR
AKVSGEPVAVRRASPVAFAVAILLAGSLAWWVFADPML