Protein Info for GFF2799 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Predicted thiazole transporter ThiU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 56 (25 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 2 to 404 (403 residues), 463.3 bits, see alignment E=3.7e-143 PF07690: MFS_1" amino acids 2 to 373 (372 residues), 104.6 bits, see alignment E=5.6e-34 PF00083: Sugar_tr" amino acids 3 to 197 (195 residues), 77.8 bits, see alignment E=8.3e-26 amino acids 248 to 415 (168 residues), 37.6 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 67% identical to Y281_HAEIN: Putative metabolite transport protein HI_0281 (HI_0281) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 67% identity to hin:HI0281)

Predicted SEED Role

"Predicted thiazole transporter ThiU" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF2799 Predicted thiazole transporter ThiU (Hydrogenophaga sp. GW460-11-11-14-LB1)
VGTAIEFYDYYIYAAAAVLVFSHQFFPQGDPTVGLLLSLSTLALAFIARPIGSALFGHYG
DRIGRKRTLVASLMTMGLSTVAIGLLPSYAQIGVAAPLLLCLFRIGQGIGLGGEWGGAAL
VATENAPKGKRGLFGSFPQLGAPIGLFAANGVFFGITWAIGPEAMVEWGWRIPFILSLVL
VIVGLYVRMTLHESQVFKEVEASGRQLKAPVSAVFTRHGGRLLQGTLIMTTTYVLFYLMT
AFVQVYSKSPAVLSEAGHPMGLGIPANTFTGILLIGAVVFGIFCLLSGHLADRLGRRRWL
IGVTVAIMAFGAVMPALLTHGTPVSVLVFIVLGMVLMGCTFGPMAALLPELFPTEVRYSG
ASMAYNLASIVGASVPTLIAIDLNRNHGLVGVGIYLAANGVLTLAALISSRETMSIDLAK
VA