Protein Info for PS417_14275 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR03707: polyphosphate kinase 2" amino acids 51 to 275 (225 residues), 378.5 bits, see alignment E=6.4e-118 PF03976: PPK2" amino acids 52 to 275 (224 residues), 370.6 bits, see alignment E=1.6e-115

Best Hits

Swiss-Prot: 80% identical to PK21B_PSEAE: Polyphosphate:ADP phosphotransferase (PA2428) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU3319)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCC5 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PS417_14275 hypothetical protein (Pseudomonas simiae WCS417)
MSSIEDALMQRIHRELLDHSDEELELELSEDGHDLNALFDEHEGESSEKAARRIYFSELF
RLQGELVKLQSWVVKTGHKVVILFEGRDAAGKGGVIKRITQRLNPRVCRVAALPAPNDRE
QTQWYFQRYVSHLPAAGEIVLFDRSWYNRAGVEQVMGFCNADQYEEFFRTVPEFERMLAR
SGIQLIKYWFSISDQEQHLRFLSRIHDPLKQWKLSPMDLESRRRWEAYTKAKEIMLERTH
IAEAPWWVVQADDKKKARLNCIHHLLGQMPYEEVELPVIELPQRVRQEDYSRSPTPPELI
VPQRY