Protein Info for PS417_14270 in Pseudomonas simiae WCS417

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12849: PBP_like_2" amino acids 25 to 305 (281 residues), 165.1 bits, see alignment E=2.8e-52 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 29 to 341 (313 residues), 437.5 bits, see alignment E=1.3e-135 PF01547: SBP_bac_1" amino acids 33 to 302 (270 residues), 58.8 bits, see alignment E=9.5e-20

Best Hits

Swiss-Prot: 40% identical to PSTS_SHIFL: Phosphate-binding protein PstS (pstS) from Shigella flexneri

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU3318)

MetaCyc: 40% identical to phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXR9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PS417_14270 phosphate ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MKRLMKSAALAVAVSLSATSVFAAESIRLTGSGASFPAPIYLTWFKDFSKKTEGVTVDYQ
SKGSGAGVQDFLNKTVDFAASDSAMKDEDIAKVAEGAQLLPMTAGEIVLAFNLPGNPKEL
KLPRDVYSNIFLGKITQWNDPKIVAANPGVKLPDMPITVVVRADSSGTTAVFTKHLAAIN
PEFQKDLGEGNTVNWPASDKFIKSPKNDGVTATVRQTPGAIGYIEYGFAKLAKVDFAQLQ
NKAGKYVVPNAESGAEALAAVKMPESLVAWLPDPDGAKSYPITSYTWMIFRKDNGNPAKA
KAMREMVEYSLTEGQKIADSMGYIPLPPSVVDQVRKASANIQ