Protein Info for GFF2796 in Variovorax sp. SCN45

Annotation: Dihydrodipicolinate synthase family protein PP2639

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00701: DHDPS" amino acids 13 to 290 (278 residues), 189.6 bits, see alignment E=2.8e-60 TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase" amino acids 16 to 289 (274 residues), 233.7 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 36% identical to DAPA_HALMA: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 83% identity to vpe:Varpa_2098)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52, 4.3.3.7

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF2796 Dihydrodipicolinate synthase family protein PP2639 (Variovorax sp. SCN45)
VPQQQNPTTHTDFSGLWVALVTPFRDGAVDHSALAALVRRLASDGVTGFVPCGSTGEAAA
LDEAEQLAVLDTVLEAAGGLPVVMGVSGYHLGKATAWARKLSERPLAGLLVSAPHYVRPS
QAGLLEWFRAIADASSVPVLVYDIPYRTGVTIARDTLLALAAHPRIRGIKDCGGDMAKTR
AVIADGRLQVLTGEDHQIFATMAEGGVGAIAASGNVQTRRFVRLVRLMAENRLAEARAEW
QALQPLVEMLFAEPNPGPVKALLAHAGEMQNELRSPMTRASDSLRERLVALDASLSRP