Protein Info for GFF2791 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 749 PF12860: PAS_7" amino acids 98 to 211 (114 residues), 51.9 bits, see alignment E=2.4e-17 amino acids 231 to 339 (109 residues), 54.4 bits, see alignment E=3.9e-18 PF00512: HisKA" amino acids 395 to 459 (65 residues), 39.8 bits, see alignment E=1.2e-13 PF02518: HATPase_c" amino acids 504 to 608 (105 residues), 92.3 bits, see alignment E=8.5e-30 PF00072: Response_reg" amino acids 633 to 744 (112 residues), 45.1 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to swi:Swit_0699)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (749 amino acids)

>GFF2791 Two-component system sensor histidine kinase (Sphingobium sp. HT1-2)
MSELRTALETDAELDALREEVRKLRKINGALMDRVERSTDMSANAFSMFETAISLEAKVR
DRTLQLEDALGRLAKANADLAEAHADADAAQVRLRDAIESINEGFVLFDAEDRLILYNEA
YLGFWPQVAERLDQNLTFHDIARIAAHSQGPAGAQVAPDRWVSDRLAKHGIADGGQVQRL
ADGRWIQINELRTSEGGIVGIYTDITEAKAEDARARARELAERNVVLQSTLDNLSEGVCV
FDGSGQLAAWNDALRRLLALPENFAGALGSHAELQRWCRETLAMDDQGCLDWRGGGADQQ
AMVCLCTAGERHFELRSNAMADGGQVFGFTDVTDMLRAQASLQETAETLERRVSERTGEL
VDLNRKLEGEVAERRAIEAALIDAKIVAEKANLSKTRFLAAASHDLLQPLNAARLFVAAL
GDRRLALPTRALVNQTSTALDSVEDLLEALLEISRLDAGAIQPEIGPFRIDRLLQTLNVE
FAPMARSAGLAFRIEAQPLWVETDLRLLRRILQNFISNAIRYTPRGTVSVACIQHDDRVE
ISVTDSGPGIAPEQQALIFEEFRRLDTRSQGKGLGLAIVKRASDMLGHPISLRSQPGQGA
TFAIALPIGQPQREEDGDTGQPTRDRSMRDLSVLVVDNEKQIQSGMRTLLTGWGCSVVTA
DGYDQAAALFADGRRPDIILVDYHLKDGETGDTVITRLHDHFGVRIPAVMISADRGEPLK
TQLAAANIPLLNKPVKPAQLRALLRTMLA