Protein Info for GFF2785 in Xanthobacter sp. DMC5

Annotation: Nitrate import ATP-binding protein NrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF00005: ABC_tran" amino acids 39 to 177 (139 residues), 115.6 bits, see alignment E=2.6e-37

Best Hits

Swiss-Prot: 53% identical to Y3647_BRUA2: Putative ATP-binding protein BAB2_1147 (BAB2_1147) from Brucella abortus (strain 2308)

KEGG orthology group: None (inferred from 73% identity to rpb:RPB_1481)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF2785 Nitrate import ATP-binding protein NrtD (Xanthobacter sp. DMC5)
MIRKPVPVPSREAGEVEIDVRDVTIAFERDGGELVPAVDRVSFQVRRGEFICLLGPSGCG
KSTLLNAVAGFETPYEGEVVVGTKVVTGPGPDRGVVFQQPRLFPWKSVRANVAHGPRMAG
KSRADAGAIADELIEMVGLSRSAKALPHTLSGGMQQRVAIARALANRPNILLMDEPFGAL
DAQTRTVMQEGLLRLWAQLDTTILFVTHDIDEAVLLADRVLVMSAGPGRIVRDLAVDLPR
PRTVETTLGARFQALRRECLDLIRQQSQKAFEGTHDA