Protein Info for GFF2784 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 61 to 82 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 239 (170 residues), 79.8 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 34% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 68% identity to bja:blr5803)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF2784 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MVVGLVSIPLFLMVWQLIAQARIVNPILFPAPTEVARAALEWVTSGLFVEDAVASLKRVA
TGYLVGSVVGVGCGLLTGRSAFFSGLLGPLFQVLRPIPPIAFVSIVILWFGLSEGGKVFL
IVWGVFFTVWLSTHLGVQKVDQGLVRAAQMLGTPRRRLVGEVVLLSALPFIVVGLRTAVG
ISFYTLVAAELAGAFAGIFYRIQLAQQNMQTGLVFAGLAALGLISFIADRCFAMLAQRLV
WWR