Protein Info for GFF2783 in Sphingobium sp. HT1-2

Annotation: MarC family integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 201 (200 residues), 182.3 bits, see alignment E=4.7e-58 PF01914: MarC" amino acids 3 to 204 (202 residues), 183 bits, see alignment E=2.5e-58

Best Hits

Swiss-Prot: 34% identical to Y1677_METJA: UPF0056 membrane protein MJ1677 (MJ1677) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 90% identity to sch:Sphch_2830)

Predicted SEED Role

"Membrane protein, MarC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>GFF2783 MarC family integral membrane protein (Sphingobium sp. HT1-2)
MMELFISAFVTLFVVIDPPGCAPIYASLTSGASIAQRRSMAIRAVGIAAAILLVFALWGK
QLLGVLGIELDSFRIAGGIMLFMIAMDMVFEKRTQRREDRAQKIAETPEVEDVSVFPMAM
PMIAGPGSIATVMLLMSRADGMVDRLVVLVAVAVTLVLMLGALLAAGPLMAILGTKIEAV
ITRLLGVLLAALAAQFVIDGLKASF