Protein Info for GFF2781 in Xanthobacter sp. DMC5

Annotation: Arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF01451: LMWPc" amino acids 11 to 142 (132 residues), 52.8 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K03741, arsenate reductase [EC: 1.20.4.1] (inferred from 80% identity to xau:Xaut_0875)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>GFF2781 Arsenate reductase (Xanthobacter sp. DMC5)
MPDTSSDHVFNVLFLCTGNSARSILAESILAKDGAGRFRAFSAGSAPKGEVNPLAIRTLN
AFGYPTYGFRSKSWLEFAEPNAPVMDFVFTVCDNAAGEACPIWPGQPMTAHWGIEDPAAV
EGSDIVREAAFNAAFRYLKNRISVFTALPITKLDRLALGTRLREIGRLEGGTDPRSDVA