Protein Info for GFF278 in Variovorax sp. SCN45

Annotation: O-methyltransferase Rv0190

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF01596: Methyltransf_3" amino acids 38 to 208 (171 residues), 140.9 bits, see alignment E=8.8e-45 PF01135: PCMT" amino acids 53 to 154 (102 residues), 30.8 bits, see alignment E=6.4e-11 PF13847: Methyltransf_31" amino acids 65 to 186 (122 residues), 29.5 bits, see alignment E=1.5e-10 PF13578: Methyltransf_24" amino acids 70 to 171 (102 residues), 63.4 bits, see alignment E=8.3e-21

Best Hits

Swiss-Prot: 40% identical to IMQG_ASPFN: O-methyltransferase imqG (imqG) from Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)

KEGG orthology group: None (inferred from 67% identity to pam:PANA_2748)

Predicted SEED Role

"O-methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF278 O-methyltransferase Rv0190 (Variovorax sp. SCN45)
MRTPDYPNPDVPKWATVDAYFSDKLAPSDEALAQALAANSTAGMPTHDVSAVQGKFLALL
VRMTGAKKVLEIGTLGGYSTIWMARALPEEGRITTLERDPVHAKVAQANFHAAGIADKVD
LRLGAAVDVLPTLQGPFDLVFIDADKPNNPAYLEWALKLSRPGTVIVGDNVVRGGAVADA
ASEDPNVVGVRRFMDMLATDSRLDSTALQTVGEKGWDGFSISVVKS