Protein Info for GFF2779 in Sphingobium sp. HT1-2

Annotation: Cytochrome c550, associated with quino(hemo)protein alcohol dehydrogenase (EC 1.1.99.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR04494: cytochrome c-550 PedF" amino acids 14 to 142 (129 residues), 208.5 bits, see alignment E=1.5e-66 PF13442: Cytochrome_CBB3" amino acids 59 to 136 (78 residues), 40 bits, see alignment E=4.2e-14 PF00034: Cytochrom_C" amino acids 61 to 102 (42 residues), 22.5 bits, see alignment E=2.4e-08

Best Hits

KEGG orthology group: None (inferred from 78% identity to swi:Swit_0691)

Predicted SEED Role

"Cytochrome C550 (Soluble cytochrome C)" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>GFF2779 Cytochrome c550, associated with quino(hemo)protein alcohol dehydrogenase (EC 1.1.99.8) (Sphingobium sp. HT1-2)
MRNYGRIALFGAACLAGASITSALMAHGNVTPQAVDTSALPEIGADWVQHNPYRGNATAA
KIGESAYGQNCARCHGLDAESGGIAPDLRYLEVGDSGDEWFIQRYQHGSSHDGKVYMPPF
GDVLGQKAGWAIRAWLETKHQE