Protein Info for GFF2778 in Variovorax sp. SCN45

Annotation: Fosmidomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 371 (346 residues), 140.9 bits, see alignment E=2.5e-45 amino acids 237 to 402 (166 residues), 44 bits, see alignment E=7.4e-16

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_2133)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF2778 Fosmidomycin resistance protein (Variovorax sp. SCN45)
MSSSSSAAVPPATTLRTDAKLIGLVGLAHAVSHFSQLILAPLFPWLKDAFNVSYVELGAV
LTVFFVVSCIVQAASGFIVDKLGPRPVLFVGLGGLGLAAFGYATAQSYWMLLVCAVIGGI
GNGVFHPVDYTLFNRKVAPTRLGHAYSVHGITGSLGWALAPAFVVPIAMAYSWRVALASA
GAVAIVVLLVLWVYRSVLSLDAAAVHKATGQGESAPAGGEFDFLRIPAVWMCFGFFFFYA
AVISVVQTFAPVAAGHLHAVPVALVAVCLTVYMVASAAGMVVGGFLASDPSRCERIVGAG
FGVAAALALVLAFASFPPIVVPVLFGMMGFVSGVAGPSRDLLVKKSTPPNATGRVYGVVY
AGLDIGQAVAPLVFGRLMDHGQYTSVIVGLALVQGVLIASAFNVRRVRRTALVPASA