Protein Info for GFF2778 in Sphingobium sp. HT1-2

Annotation: COG3391: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 16 to 320 (305 residues), 397 bits, see alignment E=5.3e-123 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 22 to 58 (37 residues), 38.2 bits, see alignment 1.1e-13 amino acids 278 to 318 (41 residues), 41.6 bits, see alignment 9e-15 PF21783: YNCE" amino acids 23 to 96 (74 residues), 34.2 bits, see alignment E=6.6e-12 amino acids 74 to 141 (68 residues), 31.3 bits, see alignment E=5e-11 PF02239: Cytochrom_D1" amino acids 70 to 152 (83 residues), 31.1 bits, see alignment E=3.3e-11 PF10282: Lactonase" amino acids 143 to 298 (156 residues), 26.4 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 77% identity to swi:Swit_0690)

Predicted SEED Role

"COG3391: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF2778 COG3391: Uncharacterized conserved protein (Sphingobium sp. HT1-2)
MMKGVIAGLALTVAIPSVRAETLYVSNERGNSVSVIDAATMQTVATWPVGGRPRGITLTK
DGKYILLCASNDHAVQMIDRATGKVVADLPSGQDPEQFFLSRDGRTLFVANEDNAALTAI
DLDSRKVAFQVDVGKEPEGVAQSPDGKWVVVTSEDDGVVNWIDLANKTMVDATETDQRPR
HVEFTADGKELWIAAEMGGTVQIADPATRRIVETLHFAIPGVQDYQLLPCGIRFTPDGKT
AVVALGRANHVALVDAATRKVRAYVPVGKRVWHVAVSPDGARAFAANGLSDNVSVIDLAA
GKVVGTVAVGAGPWGIAVAP