Protein Info for GFF2771 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 106 to 129 (24 residues), see Phobius details TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit" amino acids 1 to 149 (149 residues), 207 bits, see alignment E=5.3e-66 PF00731: AIRC" amino acids 1 to 147 (147 residues), 209.3 bits, see alignment E=9.7e-67

Best Hits

Swiss-Prot: 63% identical to PURE_VIBCH: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 88% identity to adk:Alide2_4481)

MetaCyc: 63% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF2771 Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VGVLMGSSSDWDTMQHAVQILQDFGIAHEARVVSAHRMPDDMFTYAQAAAERGLKAIIAG
AGGAAHLPGMLAAKTVVPVLGVPVASKHLSGVDSLHSIVQMPKGVPVATFAIGAAGAANA
ALFAVAMLASHDPELRHKLDTFRAQQTAAARAMTLPT