Protein Info for GFF2770 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details PF07291: MauE" amino acids 7 to 130 (124 residues), 83.9 bits, see alignment E=6e-28

Best Hits

Swiss-Prot: 40% identical to MAUE_PARDE: Methylamine utilization protein MauE (mauE) from Paracoccus denitrificans

KEGG orthology group: None (inferred from 40% identity to pde:Pden_4731)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>GFF2770 hypothetical protein (Sphingobium sp. HT1-2)
MAQGLAIAALAAAIGIGLILLQAGVSKLRHRILLPGVIANYRLLPPALVAPAAILLPLAE
IAIGATLIAGLAPVPVLLAMLLLSLFAGAMAINIARGRSHIDCGCGRSQLRHPIGWPLVI
RNLLLVALVAPRLLPAPPLSVLDIATAAAGGIALFLAFHLLGAILALIATPAAAYRR