Protein Info for GFF277 in Xanthobacter sp. DMC5

Annotation: Manganese import ATP-binding protein ScaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 90.8 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 36% identical to MNTB_BACHD: Manganese transport system ATP-binding protein MntB (mntB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02074, zinc/manganese transport system ATP-binding protein (inferred from 89% identity to xau:Xaut_4707)

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF277 Manganese import ATP-binding protein ScaC (Xanthobacter sp. DMC5)
MSAQISFRNLTLGYERHPAVHHLSGEVKQGALLAICGANGAGKSTLLKGIGGALKPIGGS
IDRHGLDPREIAYLPQGAEIDRSFPIHVYDMVSMGLWRRAGLFGGIGRADRTKIEHAIAA
VGLEGFETRPIGTLSGGQMQRTLFARLLLQDARVILLDEPFTALDAKTVSDLVDLVRRWH
GEKRTVIAVLHDFDLVRATFPETLLLARTPVAWGPTAEALGPENLLKARRLGESWRDDAV
PCSDAA