Protein Info for GFF2767 in Xanthobacter sp. DMC5

Annotation: Glyoxylate/hydroxypyruvate reductase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 33 to 326 (294 residues), 46.1 bits, E=3.9e-16
• PF02826: 2-Hacid_dh_C
  • amino acids 127 to 299 (173 residues), 182.9 bits, E=3.7e-58

Best Hits

KEGG orthology group: None (inferred from 50% identity to gob:Gobs_3683)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Protein Sequence (351 amino acids)

>GFF2767 Glyoxylate/hydroxypyruvate reductase B (Xanthobacter sp. DMC5)
MNENSPHPKSSIPNPFRVAILDDYQSVAARFWPQGAIPGVETVAFSDHVATSEDLVRRLR
GFHAVMRIRERTAFPADVINALPDLKVILATGMRNARSIDLAAADARGIFVCATDALHQT
TVEVTWALIFSLTRRMPQETASLRAGGWQIGLGRNLAGLTLGIVGLGNMGIPVSRIGQIL
GMKVVAWSPNLTPERTAPHGVECVSKSDLFRMSDVITIHMPLTDATLGLVGDTELAAMKR
DAVIINTARPQIVNEEALVRALLERRIGGAGLDVFEIEPLPKDHPFRTLTNVVATPHIGF
VTEANYEIFYGQTIENLRAWLAGAPINQITAARPFLPDSQVARQMFAAGHV