Protein Info for PS417_14115 in Pseudomonas simiae WCS417

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 25 to 249 (225 residues), 199.5 bits, see alignment E=6.9e-63 PF01547: SBP_bac_1" amino acids 30 to 240 (211 residues), 61.3 bits, see alignment E=1.6e-20 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 30 to 247 (218 residues), 262.5 bits, see alignment E=1.8e-82

Best Hits

Swiss-Prot: 70% identical to MODA_AZOVI: Molybdate-binding protein ModA (modA) from Azotobacter vinelandii

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 96% identity to pfs:PFLU2971)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC97 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PS417_14115 molybdate ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MKIHASRMAVLVAALAFGSAHADEVQVAVAANFTAPIQAIAADFEKDTGHTLVAAYGATG
QFYTQIKNGAPFEVFLSADDTTPQKLEAEGDAVKGSRFTYAVGTLALWSAKEGYVDAKGD
VLKKNEFKHLSIANPKAAPYGLAATQVLAKEGLTEKVKDKIVEGQNITQAYQFVSTGNAE
LGFVALSQIYKDGKVSSGSAWIVPAALHDPIKQDAVILNKGKDSAAAKALVDYLKGPKAA
AVIQSYGYELAK