Protein Info for GFF2766 in Variovorax sp. SCN45

Annotation: Pentapeptide repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF13599: Pentapeptide_4" amino acids 29 to 100 (72 residues), 56 bits, see alignment E=7e-19 PF00805: Pentapeptide" amino acids 30 to 55 (26 residues), 17.7 bits, see alignment (E = 4.3e-07) amino acids 53 to 92 (40 residues), 23.3 bits, see alignment 7.4e-09 amino acids 83 to 120 (38 residues), 33.3 bits, see alignment 5.8e-12 amino acids 135 to 172 (38 residues), 27.3 bits, see alignment 4.3e-10 amino acids 175 to 203 (29 residues), 19.2 bits, see alignment 1.4e-07 PF13576: Pentapeptide_3" amino acids 55 to 98 (44 residues), 31.2 bits, see alignment 4.1e-11 amino acids 155 to 196 (42 residues), 28.8 bits, see alignment 2.4e-10

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_2151)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF2766 Pentapeptide repeat family protein (Variovorax sp. SCN45)
MTRLISDQTWSRPDLLACLQERRDSEPLHFERCDFDGADLSRLDLRSVQFTLCNFAEASF
DRALLSDTRWAGCRARQADFGLADLTNARFQDCDLNNTQWARAKMASAFFSGVKLTGAHF
GEVSALGIGFKDSLLVDAHLRGMSFRKQTLEQLDFSEADLSGCDFREAVFEGGSLRNAHL
KLARFEGADLREVDLGGLRLANAAQFKGATISHRQAASLVEELGLRVV