Protein Info for GFF2766 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 36 to 182 (147 residues), 98.8 bits, E=1.4e-32
• PF00583: Acetyltransf_1
  • amino acids 40 to 159 (120 residues), 53.5 bits, E=5.5e-18
• PF13673: Acetyltransf_10
  • amino acids 83 to 163 (81 residues), 29.8 bits, E=1.1e-10
• PF13508: Acetyltransf_7
  • amino acids 86 to 160 (75 residues), 43.6 bits, E=6.3e-15
• PF08445: FR47
  • amino acids 105 to 161 (57 residues), 23.7 bits, E=7.6e-09

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 58% identity to ajs:Ajs_3941)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Protein Sequence (193 amino acids)

>GFF2766 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDTTLNAPTAWPLPDTERPPATRERRIAFAAMTEADLDAVRAVEVAAYAHPWSHKHFHDS
LQAGYPAVLLLGEALPNEKAPAVQVDGRVLLGYLVAMPGVDEVHLLNITVAPAHQRQGWA
RFMLDALVLWSRGQQAQWLWLEVRQSNEAARRLYERYGFSQVGLRKGYYPDGHLRREDAV
VMSLNLAAVRSPR